Kisspeptin-54 (27-54) (human) trifluoroacetate salt

H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-931	1mg	530.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	1135442-77-1
Sequence	IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂
Synonyms	KiSS-1 (94-121) (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human), Metastin (27-54) (human)
Molecular Formula	C₁₄₉H₂₂₆N₄₂O₃₉
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document